PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02845.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 358aa    MW: 40616.9 Da    PI: 8.6483
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02845.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding538e-17105151148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g WT  Ed llv++v+ +G++ W+ Ia++++ gR +kqc++rw+++l
  Rsa1.0_02845.1_g00002.1 105 KGQWTSGEDRLLVQLVEHHGTKKWSHIAKMLQ-GRVGKQCRERWHNHL 151
                              799*****************************.*************97 PP

2Myb_DNA-binding49.11.3e-15158199245
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              + W++eEd +l+ a+k+ G++ W+ Iar+++  Rt++ +k++w+
  Rsa1.0_02845.1_g00002.1 158 DGWSEEEDMILISAHKEIGNK-WAEIARKLP-ERTENTIKNHWN 199
                              56*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.429100155IPR017930Myb domain
SuperFamilySSF466892.88E-30102198IPR009057Homeodomain-like
SMARTSM007177.2E-15104153IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-27106158IPR009057Homeodomain-like
CDDcd001675.87E-13108151No hitNo description
PfamPF139211.1E-18108165No hitNo description
PROSITE profilePS5129417.585156206IPR017930Myb domain
SMARTSM007174.6E-14156204IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-20159204IPR009057Homeodomain-like
CDDcd001671.99E-10160202No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MTCSTSSPLK DASKILHAPR EITMWGNDQP QGTIFEYKSL FNLAIADSNL YDTSKPMGIW  60
SANEDDVMNQ CQNNQIVIKT DQIKKDKRFQ LRRGCKPMKK ANIIKGQWTS GEDRLLVQLV  120
EHHGTKKWSH IAKMLQGRVG KQCRERWHNH LRPDIKKDGW SEEEDMILIS AHKEIGNKWA  180
EIARKLPERT ENTIKNHWNA TKRRQYSRRS KGKDETSLAI CSSTLQNYIR SITYNDDTLM  240
TSATFHANAN ENTKFSPKHM RGKGKVLTVA ASDYAKNNDH ENECKYIVDG VMNLGLDDGK  300
NTSSSAVTST SGSTSRPGSG LTVEFDESMT DTWMVMHGCD EVMMNEIALL ELISDGRL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-421032052104MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-421032052104C-Myb DNA-Binding Domain
1msf_C2e-421032052104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1896330.0AC189633.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrS004A14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013647490.10.0PREDICTED: myb-like protein Q isoform X2
TrEMBLM4E9430.0M4E943_BRARP; Uncharacterized protein
STRINGBra025299.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM60522643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.11e-158myb domain protein 118